Recombinant Human ZDHHC15 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens zinc finger DHHC-type palmitoyltransferase 15 (ZDHHC15), transcript variant 1 (NM_144969).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96MV8
Entry Name ZDH15_HUMAN
Gene Names ZDHHC15 UNQ1969/PRO4501
Alternative Gene Names
Alternative Protein Names Palmitoyltransferase ZDHHC15 (EC 2.3.1.225) (Acyltransferase ZDHHC15) (EC 2.3.1.-) (Zinc finger DHHC domain-containing protein 15) (DHHC-15)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 337
Molecular Weight(Da) 39331
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
Background
Function FUNCTION: Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates (PubMed:18817523, PubMed:23034182). Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA (By similarity). Palmitoylates IGF2R and SORT1, promoting their partitioning to an endosomal membrane subdomain where they can interact with the retromer cargo-selective complex (PubMed:18817523). Thereby, regulates retrograde transport from endosomes to the Golgi apparatus of these lysosomal sorting receptors and plays a role in trafficking of lysosomal proteins (PubMed:18817523). In the nervous system, catalyzes the palmitoylation of DLG4/PSD95 and regulates its synaptic clustering and function in synaptogenesis (By similarity). Could be involved in the differentiation of dopaminergic neurons and the development of the diencephalon (By similarity). Could also catalyze the palmitoylation of GAP43 (By similarity). Could also palmitoylate DNAJC5 and regulate its localization to the Golgi membrane (By similarity). Could also palmitoylate FYN as shown in vitro (PubMed:19956733). {ECO:0000250|UniProtKB:F1QXD3, ECO:0000250|UniProtKB:Q8BGJ0, ECO:0000269|PubMed:18817523, ECO:0000269|PubMed:19956733, ECO:0000269|PubMed:23034182}.
Pathway
Protein Families DHHC palmitoyltransferase family
Tissue Specificity Expressed in placenta, liver, lung, kidney, heart and brain. {ECO:0000269|PubMed:15915161}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8492086

Recombinant Human ZDHHC15 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ZDHHC15 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.