Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens X-C motif chemokine ligand 1 (XCL1) (NM_002995). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P47992 |
| Entry Name | XCL1_HUMAN |
| Gene Names | XCL1 LTN SCYC1 |
| Alternative Gene Names | LTN SCYC1 |
| Alternative Protein Names | Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 114 |
| Molecular Weight(Da) | 12517 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Background
| Function | FUNCTION: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment. {ECO:0000250|UniProtKB:P47993}. |
| Pathway | |
| Protein Families | Intercrine gamma family |
| Tissue Specificity | Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |