Recombinant Human WFDC6 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens WAP four-disulfide core domain 6 (WFDC6) (NM_080827).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BQY6
Entry Name WFDC6_HUMAN
Gene Names WFDC6 C20orf171 WAP6
Alternative Gene Names C20orf171 WAP6
Alternative Protein Names WAP four-disulfide core domain protein 6 (Putative protease inhibitor WAP6)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 131
Molecular Weight(Da) 14626
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKIYAVCHRRLAPAWPPYHTGGTIKKTKICSEFIYGGSQGNNNNFQTEAICLVTCKKYH
Background
Function
Pathway
Protein Families
Tissue Specificity Ubiquitously expressed, but the highest levels are found in epididymis, testis and trachea.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8440865

Recombinant Human WFDC6 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human WFDC6 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.