Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1(CACNA2D1),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P54289
Gene Names CACNA2D1
Alternative Names Voltage-gated calcium channel subunit alpha-2/delta-1
Expression Region Partial(528-668aa )
Molecular Weight 32.3 kDa
Protein Sequence QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling
Involvement in Disease
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Calcium channel subunit alpha-2/delta family
Tissue Specificity CACNA2D1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE7HU4532

Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1(CACNA2D1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1(CACNA2D1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.