Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P18206 |
Gene Names | VCL |
Alternative Names | Metavinculin ;MV |
Expression Region | Partial(2-235aa ) |
Molecular Weight | 53 kDa |
Protein Sequence | PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Actin filament (F-actin)-binding protein involved in cell-matrix adhesion and cell-cell adhesion. Regulates cell-surface E-cadherin expression and potentiates mechanosensing by the E-cadherin complex. May also play important roles in cell morphology and locomotion. |
Involvement in Disease | Cardiomyopathy, dilated 1W (CMD1W); Cardiomyopathy, familial hypertrophic 15 (CMH15) |
Subcellular Location | Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell junction, adherens junction, Cell junction, focal adhesion, Cytoplasm, cytoskeleton, Cell membrane, sarcolemma, Peripheral membrane protein, Cytoplasmic side |
Protein Families | Vinculin/alpha-catenin family |
Tissue Specificity | VCL |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |