Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P63027
Gene Names VAMP2
Alternative Names Synaptobrevin-2
Expression Region Full Length(1-116aa )
Molecular Weight 39.7 kDa
Protein Sequence MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Involvement in Disease
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families Synaptobrevin family
Tissue Specificity VAMP2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1HU25906

Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Vesicle-associated membrane protein 2(VAMP2)
Copyright © 2021-present Echo Biosystems. All rights reserved.