Recombinant Human VCX3A protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens variable charge X-linked 3A (VCX3A) (NM_016379).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NNX9
Entry Name VCX3_HUMAN
Gene Names VCX3A VCX3 VCX8R VCXA
Alternative Gene Names VCX3 VCX8R VCXA
Alternative Protein Names Variable charge X-linked protein 3 (Variable charge protein on X with eight repeats) (VCX-8r) (Variably charged protein X-A) (VCX-A)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 186
Molecular Weight(Da) 20020
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSV
Background
Function FUNCTION: May mediate a process in spermatogenesis or may play a role in sex ratio distortion.
Pathway
Protein Families VCX/VCY family
Tissue Specificity Expressed exclusively in testis.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8696435

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human VCX3A protein
Copyright © 2021-present Echo Biosystems. All rights reserved.