Recombinant Human VCPKMT protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens valosin containing protein lysine methyltransferase (VCPKMT), transcript variant 1 (NM_024558).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9H867
Entry Name MT21D_HUMAN
Gene Names VCPKMT C14orf138 METTL21D
Alternative Gene Names C14orf138 METTL21D
Alternative Protein Names Protein N-lysine methyltransferase METTL21D (EC 2.1.1.-) (Methyltransferase-like protein 21D) (VCP lysine methyltransferase) (VCP-KMT) (Valosin-containing protein lysine methyltransferase)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 229
Molecular Weight(Da) 25807
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS
Background
Function FUNCTION: Protein N-lysine methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity. {ECO:0000269|PubMed:22948820, ECO:0000269|PubMed:23349634}.
Pathway
Protein Families Methyltransferase superfamily, METTL21 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8116946

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human VCPKMT protein
Copyright © 2021-present Echo Biosystems. All rights reserved.