Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P49767 |
| Gene Names | VEGFC |
| Alternative Names | Flt4 ligand ;Flt4-LVascular endothelial growth factor-related protein ;VRP |
| Expression Region | Full Length of Mature Protein(112-227aa ) |
| Molecular Weight | 40.1 kDa |
| Protein Sequence | AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systs during bryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. |
| Involvement in Disease | Lymphedema, hereditary, 1D (LMPH1D) |
| Subcellular Location | Secreted |
| Protein Families | PDGF/VEGF growth factor family |
| Tissue Specificity | VEGFC |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |