Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q16864 |
| Gene Names | ATP6V1F |
| Alternative Names | V-ATPase 14KDA subunitVacuolar proton pump subunit F |
| Expression Region | Full Length(1-119aa ) |
| Molecular Weight | 40.4 kDa |
| Protein Sequence | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assbly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | V-ATPase F subunit family |
| Tissue Specificity | ATP6V1F |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |