Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q7Z7D3 |
| Gene Names | B7H4 |
| Alternative Names | B7 homolog 4 ;B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7x |
| Expression Region | Partial(26-258aa ) |
| Molecular Weight | 52.6 kDa |
| Protein Sequence | IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Tissue Specificity | B7H4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |