Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Protein Tag | C-terminal 10xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
| Uniprot ID | Q9Y279 |
| Gene Names | VSIG4 |
| Alternative Names | (Protein Z39Ig) |
| Expression Region | 20-283aa |
| Product Form | Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1387 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1506℃. |
| Protein Length | Partial |
| Molecular Weight | 30.6 kDa |
| Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
Background
| Research Areas | Immunology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |