Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9P2H0 |
| Gene Names | KIAA1377 |
| Alternative Names | CEP126; KIAA1377; Centrosomal protein of 126 kDa |
| Expression Region | Partial(559-670aa ) |
| Molecular Weight | 28.9 kDa |
| Protein Sequence | HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation . |
| Involvement in Disease | |
| Subcellular Location | Midbody, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, cilium basal body |
| Protein Families | |
| Tissue Specificity | KIAA1377 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |