Recombinant Human UNC50 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens unc-50 inner nuclear membrane RNA binding protein (UNC50), transcript variant 3 (NM_014044).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q53HI1
Entry Name UNC50_HUMAN
Gene Names UNC50 UNCL HSD-23 HSD23
Alternative Gene Names UNCL
Alternative Protein Names Protein unc-50 homolog (Periodontal ligament-specific protein 22) (PDLs22) (Protein GMH1 homolog) (hGMH1) (Uncoordinated-like protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 259
Molecular Weight(Da) 30373
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK
Background
Function FUNCTION: Involved in the cell surface expression of neuronal nicotinic receptors (By similarity). Binds RNA (By similarity). {ECO:0000250|UniProtKB:O55227}.
Pathway
Protein Families Unc-50 family
Tissue Specificity Present in periodontal ligament fibroblasts (at protein level). {ECO:0000269|PubMed:17004066}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8269055

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human UNC50 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.