Recombinant Human ULBP2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens UL16 binding protein 2 (ULBP2) (NM_025217).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BZM5
Entry Name ULBP2_HUMAN
Gene Names ULBP2 N2DL2 RAET1H UNQ463/PRO791
Alternative Gene Names N2DL2 RAET1H
Alternative Protein Names UL16-binding protein 2 (ALCAN-alpha) (NKG2D ligand 2) (N2DL-2) (NKG2DL2) (Retinoic acid early transcript 1H)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 246
Molecular Weight(Da) 27368
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
Background
Function FUNCTION: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. {ECO:0000269|PubMed:11777960}.
Pathway
Protein Families MHC class I family
Tissue Specificity Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO:0000269|PubMed:11444831}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8436655

Recombinant Human ULBP2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ULBP2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.