Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Fc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprot ID | Q9BZM5 |
| Uniprot Entry Name | |
| Gene Names | ULBP2 |
| Alternative Names | NKG2D Ligand 2; N2DL-2; NKG2DL2; ALCAN-Alpha; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; ULBP2; N2DL2; RAET1H |
| Expression Region | Partial (26-217aa) |
| Molecular Weight | 51.4 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | NKG2D Ligand 2 (N2DL2) is a member of a family of cell-surface proteins. N2DL2 function as ligands for human cytomegalovirus glycoprotein UL16. N2DL2 is anchored to the membrane via a GPI-linkage. N2DL2 is bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, T cells. Engagement of NKG2D results in the activation of cytolytic activity and cytokine production by these effects cells. The ULBPs are expressed on some tumor cells and have been implicated in tumor surveillance. |
| Function | Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. |
| Involvement in disease | |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor, Endoplasmic reticulum, Secreted |
| Protein Families | MHC class I family |
| Tissue Specificity | Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. |
| Pathway | Naturalkillercellmediatedcytotoxicity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
