Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ubiquitin like 3 (UBL3) (NM_007106). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95164 |
| Entry Name | UBL3_HUMAN |
| Gene Names | UBL3 PNSC1 |
| Alternative Gene Names | PNSC1 |
| Alternative Protein Names | Ubiquitin-like protein 3 (Membrane-anchored ubiquitin-fold protein) (HsMUB) (MUB) (Protein HCG-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 117 |
| Molecular Weight(Da) | 13157 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
Background
| Function | |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Ubiquitous. {ECO:0000269|PubMed:10375635}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |