Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9Y2X8 |
| Gene Names | UBE2D4 |
| Alternative Names | E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4 |
| Expression Region | Full Length(1-147aa ) |
| Molecular Weight | 43.6 kDa |
| Protein Sequence | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Ubiquitin-conjugating enzyme family |
| Tissue Specificity | UBE2D4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |