Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ubiquitin conjugating enzyme E2 V2 (UBE2V2) (NM_003350). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q15819 |
| Entry Name | UB2V2_HUMAN |
| Gene Names | UBE2V2 MMS2 UEV2 |
| Alternative Gene Names | MMS2 UEV2 |
| Alternative Protein Names | Ubiquitin-conjugating enzyme E2 variant 2 (DDVit 1) (Enterocyte differentiation-associated factor 1) (EDAF-1) (Enterocyte differentiation-promoting factor 1) (EDPF-1) (MMS2 homolog) (Vitamin D3-inducible protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 145 |
| Molecular Weight(Da) | 16363 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
Background
| Function | FUNCTION: Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. {ECO:0000269|PubMed:10089880, ECO:0000269|PubMed:14562038, ECO:0000269|PubMed:20061386, ECO:0000269|PubMed:9705497}. |
| Pathway | |
| Protein Families | Ubiquitin-conjugating enzyme family |
| Tissue Specificity | Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues. {ECO:0000269|PubMed:9199207, ECO:0000269|PubMed:9705497}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |