Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ubiquitin conjugating enzyme E2 D4 (putative) (UBE2D4) (NM_015983). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y2X8 |
| Entry Name | UB2D4_HUMAN |
| Gene Names | UBE2D4 UBCH5D |
| Alternative Gene Names | UBCH5D |
| Alternative Protein Names | Ubiquitin-conjugating enzyme E2 D4 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme D4) (HBUCE1) (Ubiquitin carrier protein D4) (Ubiquitin-protein ligase D4) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 16649 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM |
Background
| Function | FUNCTION: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination. {ECO:0000269|PubMed:20061386}. |
| Pathway | Protein modification; protein ubiquitination. |
| Protein Families | Ubiquitin-conjugating enzyme family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |