Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P08579 |
| Gene Names | SNRPB2 |
| Alternative Names | 2810052G09Rik; MGC24807; MGC45309; Msl1; OTTHUMP00000030324; OTTHUMP00000030325; OTTMUSP00000016621; OTTMUSP00000016622; RP23-371L4.1; RU2B_HUMAN; Small nuclear ribonucleoprotein polypeptide B; Small nuclear ribonucleoprotein polypeptide B2; SNRPB2; U2 small nuclear ribonucleoprotein B''; U2 snRNP B''; U2B'' |
| Expression Region | Full Length(1-225aa ) |
| Molecular Weight | 41.5 kDa |
| Protein Sequence | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds st loop IV of U2 snRNA only in presence of the U2A' protein. |
| Involvement in Disease | |
| Subcellular Location | Nucleus |
| Protein Families | RRM U1 A/B'' family |
| Tissue Specificity | SNRPB2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |