Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P54829
Gene Names PTPN5
Alternative Names Neural-specific protein-tyrosine phosphatase;Striatum-enriched protein-tyrosine phosphatase ;STEP
Expression Region Partial(300-555aa )
Molecular Weight 45.5 kDa
Protein Sequence LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.
Involvement in Disease
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Protein-tyrosine phosphatase family, Non-receptor class subfamily
Tissue Specificity PTPN5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE2HU19167

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.