Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P30556 |
Gene Names | AGTR1 |
Alternative Names | AT1ARAT1BRAngiotensin II type-1 receptor ;AT1 |
Expression Region | Partial(297-359aa ) |
Molecular Weight | 9.2 kDa |
Protein Sequence | LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. |
Involvement in Disease | Renal tubular dysgenesis (RTD) |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | G-protein coupled receptor 1 family |
Tissue Specificity | AGTR1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |