Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Fc-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q07011 |
| Uniprot Entry Name | |
| Gene Names | TNFRSF9 |
| Alternative Names | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA |
| Expression Region | Extracellular Domain (24-186aa) |
| Molecular Weight | 44.2 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL). |
| Function | Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. |
| Involvement in disease | |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | |
| Tissue Specificity | Expressed on the surface of activated T-cells. |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |