Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal Fc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Uniprot ID P43489
Uniprot Entry Name
Gene Names TNFRSF4
Alternative Names Tumor necrosis factor receptor superfamily member 4;ACT35 antigen;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;TNFRSF4;OX40;CD134;Txgp1
Expression Region Partial (29-216aa)
Molecular Weight 46.8 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance OX40,also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.
Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Involvement in disease Immunodeficiency 16 (IMD16)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$165.00
In stock
SKU
EB-CAPHU5376

Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.