Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P36941
Gene Names LTBR
Alternative Names Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III ;TNF-RIII ;TNFR-III
Expression Region Extracellular Domain(31-224aa )
Molecular Weight 25.4 kDa
Protein Sequence QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Involvement in Disease
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families
Tissue Specificity LTBR
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR94h81419

Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.