Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q93038 |
| Gene Names | TNFRSF25 |
| Alternative Names | Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Short name:LARD |
| Expression Region | Extracellular Domain(25-199aa ) |
| Molecular Weight | 22.9 kDa |
| Protein Sequence | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 9: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 11: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted, SUBCELLULAR LOCATION: Isoform 7: Secreted, SUBCELLULAR LOCATION: Isoform 8: Secreted, SUBCELLULAR LOCATION: Isoform 10: Secreted, SUBCELLULAR LOCATION: Isoform 12: Secreted |
| Protein Families | |
| Tissue Specificity | TNFRSF25 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |