Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P20333 |
| Gene Names | TNFRSF1B |
| Alternative Names | Tumor necrosis factor receptor 2 ;TNF-R2Tumor necrosis factor receptor type II ;TNF-RII ;TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept |
| Expression Region | Partial(23-257aa ) |
| Molecular Weight | 25.9 kDa |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Tumor necrosis factor-binding protein 2: Secreted |
| Protein Families | |
| Tissue Specificity | TNFRSF1B |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |