Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P19438 |
| Gene Names | TNFRSF1A |
| Alternative Names | Tumor necrosis factor receptor 1 ;TNF-R1Tumor necrosis factor receptor type I ;TNF-RI ;TNFR-Ip55p60; CD120a |
| Expression Region | Partial(31-210aa ) |
| Molecular Weight | 47.2 kDa |
| Protein Sequence | VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. |
| Involvement in Disease | Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted |
| Protein Families | |
| Tissue Specificity | TNFRSF1A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |