Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Uniprot ID Q02223
Uniprot Entry Name
Gene Names Tnfrsf17
Alternative Names B-cell maturation protein (CD_antigen: CD269)
Expression Region Partial (1-54aa)
Molecular Weight 34.8 kDa
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity.
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$196.00
In stock
SKU
EB-CMPHU1239866

Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.