Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID O14798
Uniprot Entry Name
Gene Names TNFRSF10C
Alternative Names Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID
Expression Region Partial (26-221aa)
Molecular Weight 21.78 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn’t transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.
Function Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
Involvement in disease
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
Tissue Specificity Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
Pathway Apoptosis
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$70.00
In stock
SKU
EB-CAPHU5086

Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.