Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal hFc-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O43557
Gene Names TNFSF14
Alternative Names Herpes virus entry mediator ligand (HVEM-L) (Herpesvirus entry mediator ligand) (HVEML) (CD_antigen: CD258) (LIGHT)
Expression Region Partial(74-240aa )
Molecular Weight 48.3
Protein Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity TNFSF14
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$356.00
In stock
SKU
EB-PM1HU24116

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.