Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info N-terminal hFC-Myc-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Uniprot ID O43557
Uniprot Entry Name
Gene Names TNFSF14
Alternative Names (Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEML)(LIGHT)(UNQ391)(PRO726)
Expression Region Partial (74-240aa)
Molecular Weight 46.7 kDa
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:9462508, PubMed:10754304). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304).
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$151.00
In stock
SKU
EB-CMPHUj2240037

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.