Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95379 |
| Gene Names | TNFAIP8 |
| Alternative Names | Head and neck tumor and metastasis-related protein;MDC-3.13NF-kappa-B-inducible DED-containing protein ;NDEDSCC-S2TNF-induced protein GG2-1 |
| Expression Region | Full Length of Mature Protein(2-198aa ) |
| Molecular Weight | 49.9 kDa |
| Protein Sequence | HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | TNFAIP8 family |
| Tissue Specificity | TNFAIP8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |