Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | C-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P07478 |
| Gene Names | PRSS2 |
| Alternative Names | (Anionic trypsinogen)(Serine protease 2)(Trypsin II) |
| Expression Region | 16-247aa(K23Q,S167G) |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.11 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-103℃. |
| Protein Length | Partial |
| Molecular Weight | 25.9 kDa |
| Protein Sequence | APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS |
Background
| Research Areas | Cell Biology |
| Relevance | In the ileum, may be involved in defensin processing, including DEFA5. |
| Function | |
| Reference | "Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |