Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens tRNA methyltransferase subunit 11-2 (TRMT112), transcript variant 1 (NM_016404). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UI30 |
| Entry Name | TR112_HUMAN |
| Gene Names | TRMT112 AD-001 HSPC152 HSPC170 |
| Alternative Gene Names | |
| Alternative Protein Names | Multifunctional methyltransferase subunit TRM112-like protein (tRNA methyltransferase 112 homolog) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 125 |
| Molecular Weight(Da) | 14199 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
Background
| Function | FUNCTION: Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604, PubMed:18539146, PubMed:20308323, PubMed:25851604, PubMed:31328227, PubMed:31636962, PubMed:31061526). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146, PubMed:31636962, PubMed:31061526). The heterodimer with HEMK2/N6AMT1 also monomethylates 'Lys-12' of histone H4 (H4K12me1) (PubMed:31061526). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604). Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (PubMed:33428944, PubMed:31328227). {ECO:0000269|PubMed:18539146, ECO:0000269|PubMed:20308323, ECO:0000269|PubMed:25851604, ECO:0000269|PubMed:31061526, ECO:0000269|PubMed:31328227, ECO:0000269|PubMed:31636962, ECO:0000269|PubMed:33428944}. |
| Pathway | |
| Protein Families | TRM112 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |