Recombinant Human TRIM31 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens tripartite motif containing 31 (TRIM31), transcript variant 1 (NM_007028).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BZY9
Entry Name TRI31_HUMAN
Gene Names TRIM31 C6orf13 RNF
Alternative Gene Names C6orf13 RNF
Alternative Protein Names E3 ubiquitin-protein ligase TRIM31 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM31) (Tripartite motif-containing protein 31)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 425
Molecular Weight(Da) 48244
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Background
Function FUNCTION: Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity. {ECO:0000250, ECO:0000269|PubMed:18773414}.
Pathway Protein modification; protein ubiquitination.
Protein Families TRIM/RBCC family
Tissue Specificity Up-regulated in gastric adenocarcinomas. {ECO:0000269|PubMed:18773414}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8284805

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TRIM31 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.