Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P55084 |
| Gene Names | HADHB |
| Alternative Names | TP-beta 1 domains:3-ketoacyl-CoA thiolase (EC:2.3.1.16) ;Acetyl-CoA acyltrans feraseBeta-ketothiolase |
| Expression Region | Partial(35-283aa ) |
| Molecular Weight | 53.8 kDa |
| Protein Sequence | APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Mitochondrial trifunctional protein deficiency (MTPD) |
| Subcellular Location | Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Endoplasmic reticulum |
| Protein Families | Thiolase family |
| Tissue Specificity | HADHB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |