Recombinant Human Tricarboxylate transport protein(SLC20A3),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P53007
Gene Names SLC20A3
Alternative Names Citrate transport protein ;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein
Expression Region Partial(47-87aa )
Molecular Weight 31.8 kDa
Protein Sequence EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Involvement in Disease Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity SLC20A3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR44h49669

Recombinant Human Tricarboxylate transport protein(SLC20A3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tricarboxylate transport protein(SLC20A3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.