Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P53007 |
| Gene Names | SLC20A3 |
| Alternative Names | Citrate transport protein ;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein |
| Expression Region | Partial(47-87aa ) |
| Molecular Weight | 31.8 kDa |
| Protein Sequence | EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway. |
| Involvement in Disease | Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD) |
| Subcellular Location | Mitochondrion inner membrane, Multi-pass membrane protein |
| Protein Families | Mitochondrial carrier (TC 2.A.29) family |
| Tissue Specificity | SLC20A3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |