Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q07654 |
Gene Names | TFF3 |
Alternative Names | Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI) |
Expression Region | Partial(29-80aa ) |
Molecular Weight | 7.5 kDa |
Protein Sequence | LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen). |
Involvement in Disease | |
Subcellular Location | Secreted, extracellular space, extracellular matrix, Cytoplasm |
Protein Families | |
Tissue Specificity | TFF3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |