Recombinant Human TRAPPC3L protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens trafficking protein particle complex 3 like (TRAPPC3L) (NM_001139444).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q5T215
Entry Name TPC3L_HUMAN
Gene Names TRAPPC3L BET3L
Alternative Gene Names BET3L
Alternative Protein Names Trafficking protein particle complex subunit 3-like protein (TRAPPC3-like protein) (BET3-like protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 181
Molecular Weight(Da) 20566
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHSYSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK
Background
Function FUNCTION: May play a role in vesicular transport from endoplasmic reticulum to Golgi. {ECO:0000250}.
Pathway
Protein Families TRAPP small subunits family, BET3 subfamily
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8101535

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TRAPPC3L protein
Copyright © 2021-present Echo Biosystems. All rights reserved.