Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q86YD3 |
| Gene Names | TMEM25 |
| Alternative Names | 0610039J01Rik; FLJ14399; Tmem25; TMM25_HUMAN; Transmembrane protein 25 |
| Expression Region | Full Length of Isoform 2(27-322aa ) |
| Molecular Weight | 48.2 kDa |
| Protein Sequence | ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted |
| Protein Families | |
| Tissue Specificity | TMEM25 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |