Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9H2K0 |
| Gene Names | MTIF3 |
| Alternative Names | DC38; IF 3 ; IF 3Mt; IF-3(Mt); IF-3Mt; IF3 ; IF3(mt); IF3M_HUMAN; IF3mt; mitochondrial; Mt; MTIF3; Translation initiation factor IF 3; mitochondrial precursor; Translation initiation factor IF-3 |
| Expression Region | Full Length(1-278aa ) |
| Molecular Weight | 55.2 kDa |
| Protein Sequence | TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion |
| Protein Families | IF-3 family |
| Tissue Specificity | MTIF3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
