Recombinant Human Translation initiation factor eIF-2B subunit alpha(EIF2B1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q14232
Gene Names EIF2B1
Alternative Names eIF-2B GDP-GTP exchange factor subunit alpha
Expression Region Full Length(1-305aa )
Molecular Weight 60.7 kDa
Protein Sequence MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Involvement in Disease Leukodystrophy with vanishing white matter (VWM)
Subcellular Location
Protein Families EIF-2B alpha/beta/delta subunits family
Tissue Specificity EIF2B1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE0HU624035

Recombinant Human Translation initiation factor eIF-2B subunit alpha(EIF2B1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Translation initiation factor eIF-2B subunit alpha(EIF2B1)
Copyright © 2021-present Echo Biosystems. All rights reserved.