Recombinant Human Transgelin(TAGLN)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q01995
Gene Names TAGLN
Alternative Names 22KDA actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha ;SM22-alpha
Expression Region Full Length of Mature Protein(2-201aa )
Molecular Weight 49.5 kDa
Protein Sequence ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Actin cross-linking/gelling protein . Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Calponin family
Tissue Specificity TAGLN
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR44h8169

Recombinant Human Transgelin(TAGLN)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Transgelin(TAGLN)
Copyright © 2021-present Echo Biosystems. All rights reserved.