Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P10600 |
| Uniprot Entry Name | |
| Gene Names | TGFB3 |
| Alternative Names | Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP |
| Expression Region | Partial (301-412aa(Y340F)) |
| Molecular Weight | 12.7 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5.) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transforming growth factor beta 3(TGFB3) is a member of a TGF -β superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3,mammals develop a deformity known as a cleft palate. |
| Function | Involved in embryogenesis and cell differentiation. |
| Involvement in disease | Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1); Loeys-Dietz syndrome 5 (LDS5) |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | |
| Pathway | Hipposignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |