Recombinant Human TPD52L2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens TPD52 like 2 (TPD52L2), transcript variant 6 (NM_199359).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q68E05
Entry Name Q68E05_HUMAN
Gene Names DKFZp686A1765 TPD52L2 hCG_22755
Alternative Gene Names TPD52L2
Alternative Protein Names Tumor protein D52-like 2, isoform CRA_f (Uncharacterized protein DKFZp686A1765) (cDNA FLJ54053, highly similar to Homo sapiens tumor protein D52-like 2 (TPD52L2), transcript variant 6, mRNA)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 186
Molecular Weight(Da) 19901
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
Background
Function
Pathway
Protein Families TPD52 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8188771

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TPD52L2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.