Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)

Specification
Uniprot ID Q9UIK5
Gene Names TMEFF2
Alternative Names (TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal 10xHis-tagged
Molecular Weight 32.3 kDa
Expression Region Partial(41-320aa )
Expression Region C-terminal 10xHis-tagged(Partial )
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Measured by its binding ability in a functional ELISA, the EC50 is 2.129-2.956 ng/mL.
Form Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$350.00
In stock
SKU
EB-M9HU2650317

Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.