Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9NYK1 |
| Gene Names | TLR7 |
| Alternative Names | PRO285; TLR 7; Tlr7; TLR7_HUMAN; Toll like receptor 7; Toll-like receptor 7; UNQ248 |
| Expression Region | Partial(861-1049aa ) |
| Molecular Weight | 29.5 kDa |
| Protein Sequence | HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum membrane, Single-pass type I membrane protein, Endosome, Lysosome, Cytoplasmic vesicle, phagosome |
| Protein Families | Toll-like receptor family |
| Tissue Specificity | TLR7 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
