Recombinant Human TMSB4X protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens thymosin beta 4 X-linked (TMSB4X) (NM_021109).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P62328
Entry Name TYB4_HUMAN
Gene Names TMSB4X TB4X THYB4 TMSB4
Alternative Gene Names TB4X THYB4 TMSB4
Alternative Protein Names Thymosin beta-4 (T beta-4) (Fx) [Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)]
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 44
Molecular Weight(Da) 5053
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Background
Function FUNCTION: Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. {ECO:0000250}.; FUNCTION: Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase. {ECO:0000250}.
Pathway
Protein Families Thymosin beta family
Tissue Specificity Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. {ECO:0000269|PubMed:3500230}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8424605

Recombinant Human TMSB4X protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TMSB4X protein
Copyright © 2026-present Echo Bio. All rights reserved.