Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens thymosin beta 4 X-linked (TMSB4X) (NM_021109). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P62328 |
| Entry Name | TYB4_HUMAN |
| Gene Names | TMSB4X TB4X THYB4 TMSB4 |
| Alternative Gene Names | TB4X THYB4 TMSB4 |
| Alternative Protein Names | Thymosin beta-4 (T beta-4) (Fx) [Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 44 |
| Molecular Weight(Da) | 5053 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Background
| Function | FUNCTION: Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. {ECO:0000250}.; FUNCTION: Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase. {ECO:0000250}. |
| Pathway | |
| Protein Families | Thymosin beta family |
| Tissue Specificity | Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. {ECO:0000269|PubMed:3500230}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |